Dried apricots are naturally sweet, soft, and packed with essential nutrients. They are an excellent source of dietary fiber, vitamin A, potassium, and iron. Regular consumption of dried apricots supports eye health, improves digestion, and helps maintain healthy skin. Their rich flavor and chewy texture make them a perfect healthy snack or a delicious addition to cereals, salads, and desserts.
Dried Apricot
In stock
Low stock
Out of stock
: 12 left
bac_1234Driedapricotsarenaturallysweet,soft,andpackedwithessentialnutrients.Theyareanexcellentsourceofdietaryfiber,vitaminA,potassium,andiron.Regularconsumptionofdriedapricotssupportseyehealth,improvesdigestion,andhelpsmaintainhealthyskin.Theirrichflavorandchewytexturemakethemaperfecthealthysnackoradeliciousadditiontocereals,salads,anddesserts.
Product Info
Health Benefits
Storage guide
Shipping Info
Sold out
Rs.6,000.00 PKR
Rs.2,000.00 PKR
Sale 67%
Quantity
| Nutrient | Amount (per 100g) |
|---|---|
| Energy | 579 kcal |
| Protein | 21.2 g |
| Total Fat | 49.9 g |
| Carbohydrates | 21.6 g |
| Dietary Fiber | 12.5 g |
| Sugars | 4.4 g |
| Calcium | 269 mg |
| Iron | 3.7 mg |
Related Product
-
American Almonds
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Anjeer
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Australian Almonds
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Black Kishmish
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Cashews Nuts
Original price: Rs.4,000.00 Sale price: Rs.3,450.00 -
Dried Apricot
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Iranian Almonds
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Iranian Kishmish
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Gurbundi Almonds
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Khairabadi Almonds
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Mamra Almonds
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Mix Dry Fruit
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Panjeeri Delights
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Peanuts
Original price: Rs.6,000.00 Sale price: Rs.2,000.00 -
Pine Nuts Chilghozy
Original price: Rs.6,000.00 Sale price: Rs.2,000.00